AI Bio 소식
[Novo Prolabs 공식 대리점]Pheromone Biosynthesis Activating Neuropeptide(303424)
- AI바이오허브 오래 전 2025.08.11 22:59 제품소개 인기
-
149
0
Pheromone Biosynthesis Activating Neuropeptide
Cat.#: 303424
Sequence shortening:LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL
Sequence:H-Leu-Ser-Asp-Asp-Met-Pro-Ala-Thr-Pro-Ala-Asp-Gln-Glu-Met-Tyr-Arg-Gln-Asp-Pro-Glu-Gln-Ile-Asp-Ser-Arg-Thr-Lys-Tyr-Phe-Ser-Pro-Arg-Leu-NH2
Length(aa):33
Peptide Purity (HPLC):97.1%
Molecular Formula:C167H259N47O57S2
Molecular weight:3901.31
Source:Synthetic
Form:Powder
Description:A pheromone biosynthesis activating neuropeptide hormone which in the picomolar range induced sex pheromone synthesis in various moth species.
Storage Guidelines:Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
References:A.K.Raina et al., Science, 244, 796 (1989)
About TFA Salt:Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.
TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.
TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.
In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.
견적 문의: aibiohub@aibiohub.co.kr 홈페이지: www.aibiohub.co.kr
견적 문의: https://aibiohub.co.kr/estimate/write
- 이전글[NZY Tech 공식 대리점]NZYSpeedy qPCR Green Master Mix (2x), ROX plus2025.08.11
- 다음글[Neochema 공식 대리점]4-Allyloxy-2-hydroxybenzophenone 4-Allyloxy-2-hydroxybenzophenone(2549-87-3)2025.08.11
댓글목록
등록된 댓글이 없습니다.

