AI Bio 소식

2025.07.15 21:51

[Creative Biomart 공식 대리점]Recombinant Human TMEM106B, GST-tagged(TMEM106B-3274H)

  • AI바이오허브 오래 전 2025.07.15 21:51 제품소개 인기
  • 100
    0

Recombinant Human TMEM106B, GST-tagged

Cat.No. :TMEM106B-3274H

Product Overview :Recombinant Human TMEM106B(150-274 aa), fused with a GST tag at the N-terminus, was expressed in E. coli.

Species :Human

Source :E.coli

Tag :GST

Protein Length :150-274 aa

Form :Lyophilized from sterile PBS, pH7.4, 0.3% SKL, 5% Trehalose, 5% Mannitol.

Molecular Mass :The protein has a calculated MW of 40.72 kDa.

Endotoxin :<1.0EU per 1μg (determined by the LAL method).

Purity : > 90 % as determined by SDS-PAGE.

Storage :Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Reconstitution :It is recommended that sterile water be added to the vial to prepare a stock solution of 0.86mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.

AA Sequence :MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ

견적 문의: aibiohub@aibiohub.co.kr  홈페이지: www.aibiohub.co.kr 

견적 문의: https://aibiohub.co.kr/estimate/write                                                       

  • 공유링크 복사